SCOP 1.71: Domain d1uzwa_: 1uzw A:

Lineage for d1uzwa_ (1uzw A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (1 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (15 PDB entries)

8. Domain d1uzwa_: 1uzw A: [108183]
   complexed with cdh, fe2, so4

Details for d1uzwa_

PDB Entry: 1uzw, 1.3 Å

PDB Description: isopenicillin n synthase with l-d-(a-aminoadipoyl)-l-cysteinyl-d-isodehydrovaline

SCOP Domain Sequences for d1uzwa_:

Sequence; same for both SEQRES and ATOM records:

>d1uzwa_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d1uzwa_:

• d1uzwa_ first appeared in SCOP 1.69
  
• d1uzwa_ appears in SCOP 1.73
  
• d1uzwa_ appears in the current release, SCOPe 2.08