![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein Ribonucleotide reductase R2 [47257] (10 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [109787] (1 PDB entry) Uniprot Q50549 10-291 |
![]() | Domain d1uzrc_: 1uzr C: [108180] complexed with cit, fe, gol |
PDB Entry: 1uzr (more details), 2.2 Å
SCOPe Domain Sequences for d1uzrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uzrc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Mycobacterium tuberculosis [TaxId: 1773]} drvsainwnrlqdekdaevwdrltgnfwlpekvpvsndipswgtltagekqltmrvftgl tmldtiqgtvgavslipdaltpheeavltniafmesvhaksysqifstlcstaeiddafr wseenrnlqrkaeivlqsyrgdeplkrkvastllesflfysgfylpmywssrakltntad mirliirdeavhgyyigykfqrglalvddvtraelkdytyellfelydneveytqdlyde vgltedvkkflrynankalmnlgyealfprdetdvnpailsal
Timeline for d1uzrc_: