Lineage for d1uzra_ (1uzr A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [109787] (1 PDB entry)
    Uniprot Q50549 10-291
  8. Domain d1uzra_: 1uzr A: [108178]
    complexed with cit, fe, gol

Details for d1uzra_

PDB Entry: 1uzr (more details), 2.2 Å

PDB Description: crystal structure of the class ib ribonucleotide reductase r2f-2 subunit from mycobacterium tuberculosis
PDB Compounds: (A:) ribonucleotide reductase r2-2 small subunit

SCOPe Domain Sequences for d1uzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mycobacterium tuberculosis [TaxId: 1773]}
rvsainwnrlqdekdaevwdrltgnfwlpekvpvsndipswgtltagekqltmrvftglt
mldtiqgtvgavslipdaltpheeavltniafmesvhaksysqifstlcstaeiddafrw
seenrnlqrkaeivlqsyrgdeplkrkvastllesflfysgfylpmywssrakltntadm
irliirdeavhgyyigykfqrglalvddvtraelkdytyellfelydneveytqdlydev
gltedvkkflrynankalmnlgyealfprdetdvnpailsal

SCOPe Domain Coordinates for d1uzra_ are not available.

Timeline for d1uzra_:

Domains from other chains:
(mouse over for more information)
d1uzrb_, d1uzrc_