Lineage for d1uzea_ (1uze A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729182Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 729189Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 729197Species Human (Homo sapiens) [TaxId:9606] [82734] (5 PDB entries)
  8. 729198Domain d1uzea_: 1uze A: [108174]
    complexed with cl, eal, gly, zn

Details for d1uzea_

PDB Entry: 1uze (more details), 1.82 Å

PDB Description: complex of the anti-hypertensive drug enalaprilat and the human testicular angiotensin i-converting enzyme
PDB Compounds: (A:) angiotensin converting enzyme

SCOP Domain Sequences for d1uzea_:

Sequence, based on SEQRES records: (download)

>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
litgqpnmsasamlsyfkplldwlrtenelhgeklgwpq

Sequence, based on observed residues (ATOM records): (download)

>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllssdehdinflmkmaldkiafipfsyl
vdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyiry
fvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitg
qpnmsasamlsyfkplldwlrtenelhgeklgwpq

SCOP Domain Coordinates for d1uzea_:

Click to download the PDB-style file with coordinates for d1uzea_.
(The format of our PDB-style files is described here.)

Timeline for d1uzea_: