![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
![]() | Domain d1uz8l2: 1uz8 L:107-210 [108173] Other proteins in same PDB: d1uz8a1, d1uz8b1, d1uz8b2, d1uz8h1, d1uz8h2, d1uz8l1 MQ P03976 P01837 # natural chimera complexed with fuc, gal, mag |
PDB Entry: 1uz8 (more details), 1.8 Å
SCOP Domain Sequences for d1uz8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz8l2 b.1.1.2 (L:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1uz8l2: