Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries) Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region |
Domain d1uz8h2: 1uz8 H:114-212 [108171] Other proteins in same PDB: d1uz8a1, d1uz8a2, d1uz8b1, d1uz8h1, d1uz8l1, d1uz8l2 MQ P01811 P22436 # ! natural chimera |
PDB Entry: 1uz8 (more details), 1.8 Å
SCOPe Domain Sequences for d1uz8h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz8h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]} atttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfysls slvtvpsstwpsqtvicnvahpasktelikriep
Timeline for d1uz8h2: