Lineage for d1uz8h2 (1uz8 H:114-212)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1293052Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
    Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
  8. 1293061Domain d1uz8h2: 1uz8 H:114-212 [108171]
    Other proteins in same PDB: d1uz8a1, d1uz8a2, d1uz8b1, d1uz8h1, d1uz8l1, d1uz8l2
    MQ P01811 P22436 # ! natural chimera

Details for d1uz8h2

PDB Entry: 1uz8 (more details), 1.8 Å

PDB Description: anti-lewis x fab fragment in complex with lewis x
PDB Compounds: (H:) igg fab (igg3, kappa) heavy chain 291-2g3-a

SCOPe Domain Sequences for d1uz8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz8h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfysls
slvtvpsstwpsqtvicnvahpasktelikriep

SCOPe Domain Coordinates for d1uz8h2:

Click to download the PDB-style file with coordinates for d1uz8h2.
(The format of our PDB-style files is described here.)

Timeline for d1uz8h2: