Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries) |
Domain d1uz8b2: 1uz8 B:114-212 [108169] Other proteins in same PDB: d1uz8a1, d1uz8a2, d1uz8b1, d1uz8h1, d1uz8l1, d1uz8l2 |
PDB Entry: 1uz8 (more details), 1.8 Å
SCOP Domain Sequences for d1uz8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz8b2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3} atttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfysls slvtvpsstwpsqtvicnvahpasktelikriep
Timeline for d1uz8b2: