Lineage for d1uz6w2 (1uz6 W:114-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785873Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
    Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
  8. 785886Domain d1uz6w2: 1uz6 W:114-212 [108165]
    Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f1, d1uz6h1, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p1, d1uz6v1, d1uz6v2, d1uz6w1
    MQ P01811 P22436 #
    natural chimera
    complexed with so4
    MQ P01811 P22436 # ! natural chimera

Details for d1uz6w2

PDB Entry: 1uz6 (more details), 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed
PDB Compounds: (W:) igg fab (igg3,kappa) heavy chain 291-2g3-a

SCOP Domain Sequences for d1uz6w2:

Sequence, based on SEQRES records: (download)

>d1uz6w2 b.1.1.2 (W:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktelikriep

Sequence, based on observed residues (ATOM records): (download)

>d1uz6w2 b.1.1.2 (W:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfysls
slvtvpsstwpsqtvicnvahpasktelikriep

SCOP Domain Coordinates for d1uz6w2:

Click to download the PDB-style file with coordinates for d1uz6w2.
(The format of our PDB-style files is described here.)

Timeline for d1uz6w2: