Lineage for d1uz6h2 (1uz6 H:114-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2359850Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
    Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region
  8. 2359861Domain d1uz6h2: 1uz6 H:114-212 [108155]
    Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f1, d1uz6h1, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p1, d1uz6v1, d1uz6v2, d1uz6w1
    MQ P01811 P22436 # ! natural chimera
    complexed with so4

Details for d1uz6h2

PDB Entry: 1uz6 (more details), 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed
PDB Compounds: (H:) igg fab (igg3, kappa) heavy chain 291-2g3-a

SCOPe Domain Sequences for d1uz6h2:

Sequence, based on SEQRES records: (download)

>d1uz6h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpasktelikriep

Sequence, based on observed residues (ATOM records): (download)

>d1uz6h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslss
lvtvpsstwpsqtvicnvahpasktelikriep

SCOPe Domain Coordinates for d1uz6h2:

Click to download the PDB-style file with coordinates for d1uz6h2.
(The format of our PDB-style files is described here.)

Timeline for d1uz6h2: