Lineage for d1uz6f1 (1uz6 F:1-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. Domain d1uz6f1: 1uz6 F:1-113 [108152]
    Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f2, d1uz6h2, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p2, d1uz6v1, d1uz6v2, d1uz6w2
    MQ P01811 P22436 # ! natural chimera
    complexed with so4

Details for d1uz6f1

PDB Entry: 1uz6 (more details), 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed
PDB Compounds: (F:) igg fab (igg3, kappa) heavy chain 291-2g3-a

SCOPe Domain Sequences for d1uz6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz6f1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvss

SCOPe Domain Coordinates for d1uz6f1 are not available.

Timeline for d1uz6f1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uz6f2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uz6e1, d1uz6e2, d1uz6h1, d1uz6h2, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p1, d1uz6p2, d1uz6v1, d1uz6v2, d1uz6w1, d1uz6w2