Lineage for d1uz6e2 (1uz6 E:107-210)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454386Domain d1uz6e2: 1uz6 E:107-210 [108151]
    Other proteins in same PDB: d1uz6e1, d1uz6f1, d1uz6f2, d1uz6h1, d1uz6h2, d1uz6l1, d1uz6m1, d1uz6p1, d1uz6p2, d1uz6v1, d1uz6w1, d1uz6w2

Details for d1uz6e2

PDB Entry: 1uz6 (more details), 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed

SCOP Domain Sequences for d1uz6e2:

Sequence, based on SEQRES records: (download)

>d1uz6e2 b.1.1.2 (E:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d1uz6e2 b.1.1.2 (E:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatpivksfnr

SCOP Domain Coordinates for d1uz6e2:

Click to download the PDB-style file with coordinates for d1uz6e2.
(The format of our PDB-style files is described here.)

Timeline for d1uz6e2: