SCOP 1.75: Domain d1uz2x_: 1uz2 X:

Lineage for d1uz2x_ (1uz2 X:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
   Uniprot P02754

8. Domain d1uz2x_: 1uz2 X: [108149]
   mutant

Details for d1uz2x_

PDB Entry: 1uz2, 1.95 Å

PDB Description: the cys121ser mutant of beta-lactoglobulin

PDB Compounds: (X:) beta-lactoglobulin

SCOP Domain Sequences for d1uz2x_:

Sequence; same for both SEQRES and ATOM records:

>d1uz2x_ b.60.1.1 (X:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
slvrtpevddealekfdkalkalpmhirlsfnptqlee

Timeline for d1uz2x_:

• d1uz2x_ first appeared in SCOP 1.69
  
• d1uz2x_ appears in SCOP 1.73
  
• d1uz2x_ appears in SCOPe 2.01
  
• d1uz2x_ appears in the current release, SCOPe 2.08