Lineage for d1uyja_ (1uyj A:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519433Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily)
    3 domains: (1) alpha+beta; (2&3) all-beta
  4. 519434Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (2 families) (S)
  5. 519440Family f.8.1.2: ETX/MTX2 (Pfam 03318) [111375] (1 protein)
  6. 519441Protein Epsilon-toxin, ETX [111376] (1 species)
  7. 519442Species Clostridium perfringens [TaxId:1502] [111377] (1 PDB entry)
  8. 519443Domain d1uyja_: 1uyj A: [108143]

Details for d1uyja_

PDB Entry: 1uyj (more details), 2.6 Å

PDB Description: clostridium perfringens epsilon toxin shows structural similarity with the pore forming toxin aerolysin

SCOP Domain Sequences for d1uyja_:

Sequence, based on SEQRES records: (download)

>d1uyja_ f.8.1.2 (A:) Epsilon-toxin, ETX {Clostridium perfringens}
sydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgndfyinnpkveldgep
smnyledvyvgkalltndtqqeqklksqsftckntdtvtattthtvgtsiqatakftvpf
netgvslttsysfantntntnskeithnvpsqdilvpanttveviaylkkvnvkgnvklv
gqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtiningkgnysavmgdelivk
vrnlntnnvqeyvipvdkkeksndsnivkyrslsikapgi

Sequence, based on observed residues (ATOM records): (download)

>d1uyja_ f.8.1.2 (A:) Epsilon-toxin, ETX {Clostridium perfringens}
sydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgndfyinnpkveldgep
smnyledvyvgkalltndtqqeqklksqsftckntdtvtattthtvgtsiqatakftvpf
netgvslttsysfantntntnskeithnvpsqdilvpanttveviaylkkvnvkgnvklv
gqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtiningkgnysavmgdelivk
vrnlntnnvqeyvipvdsnivkyrslsikapgi

SCOP Domain Coordinates for d1uyja_:

Click to download the PDB-style file with coordinates for d1uyja_.
(The format of our PDB-style files is described here.)

Timeline for d1uyja_: