SCOPe 2.05: Domain d1uyha_: 1uyh A:

Lineage for d1uyha_ (1uyh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (80 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d1uyha_: 1uyh A: [108141]
   complexed with pu0

Details for d1uyha_

PDB Entry: 1uyh, 2.2 Å

PDB Description: human hsp90-alpha with 9-butyl-8-(2,5-dimethoxy-benzyl)-2-fluoro-9h- purin-6-ylamine

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d1uyha_:

Sequence; same for both SEQRES and ATOM records:

>d1uyha_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

Timeline for d1uyha_:

• d1uyha_ first appeared in SCOP 1.69
  
• d1uyha_ appears in SCOPe 2.04
  
• d1uyha_ appears in SCOPe 2.06
  
• d1uyha_ appears in the current release, SCOPe 2.08