Lineage for d1uyfa_ (1uyf A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610241Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 610242Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 610243Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 610244Protein HSP90 [55876] (3 species)
  7. 610266Species Human (Homo sapiens) [TaxId:9606] [55878] (19 PDB entries)
  8. 610281Domain d1uyfa_: 1uyf A: [108139]
    complexed with pu1

Details for d1uyfa_

PDB Entry: 1uyf (more details), 2 Å

PDB Description: human hsp90-alpha with 8-(2-chloro-3,4,5-trimethoxy-benzyl)-2-fluoro- 9-pent-4-ylnyl-9h-purin-6-ylamine

SCOP Domain Sequences for d1uyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyfa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens)}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOP Domain Coordinates for d1uyfa_:

Click to download the PDB-style file with coordinates for d1uyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1uyfa_: