Lineage for d1uy8a_ (1uy8 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. Protein HSP90 [55876] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. Domain d1uy8a_: 1uy8 A: [108134]
    complexed with pu5

Details for d1uy8a_

PDB Entry: 1uy8 (more details), 1.98 Å

PDB Description: human hsp90-alpha with 9-butyl-8-(3-trimethoxy-benzyl)-9h-purin-6ylamine
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d1uy8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uy8a_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d1uy8a_ are not available.

Timeline for d1uy8a_: