Lineage for d1uy4a_ (1uy4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774520Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 2774545Protein Putative xylanase [89239] (1 species)
  7. 2774546Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries)
    Uniprot P33558 243-374, 384-512
  8. 2774549Domain d1uy4a_: 1uy4 A: [108131]
    CBM6-2
    complexed with ca, gol, na

Details for d1uy4a_

PDB Entry: 1uy4 (more details), 1.69 Å

PDB Description: binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1uy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uy4a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]}
spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
vnvdnfifsrss

SCOPe Domain Coordinates for d1uy4a_:

Click to download the PDB-style file with coordinates for d1uy4a_.
(The format of our PDB-style files is described here.)

Timeline for d1uy4a_: