Lineage for d1uy3a_ (1uy3 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384202Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 2384227Protein Putative xylanase [89239] (1 species)
  7. 2384228Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries)
    Uniprot P33558 243-374, 384-512
  8. 2384236Domain d1uy3a_: 1uy3 A: [108130]
    CBM6-2
    complexed with ca, gol, na, xyp

Details for d1uy3a_

PDB Entry: 1uy3 (more details), 1.89 Å

PDB Description: binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1uy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uy3a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]}
spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
vnvdnfifsrss

SCOPe Domain Coordinates for d1uy3a_:

Click to download the PDB-style file with coordinates for d1uy3a_.
(The format of our PDB-style files is described here.)

Timeline for d1uy3a_: