Lineage for d1uy2a_ (1uy2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459075Family b.18.1.10: CBM6 [69213] (3 proteins)
  6. 459093Protein Putative xylanase [89239] (1 species)
  7. 459094Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries)
  8. 459098Domain d1uy2a_: 1uy2 A: [108129]

Details for d1uy2a_

PDB Entry: 1uy2 (more details), 1.7 Å

PDB Description: binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry

SCOP Domain Sequences for d1uy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uy2a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium}
spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
vnvdnfifsrs

SCOP Domain Coordinates for d1uy2a_:

Click to download the PDB-style file with coordinates for d1uy2a_.
(The format of our PDB-style files is described here.)

Timeline for d1uy2a_: