Lineage for d1uy1a_ (1uy1 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555066Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 555091Protein Putative xylanase [89239] (1 species)
  7. 555092Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries)
  8. 555097Domain d1uy1a_: 1uy1 A: [108128]
    CBM6-2
    complexed with ca, gol, na

Details for d1uy1a_

PDB Entry: 1uy1 (more details), 1.8 Å

PDB Description: binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry

SCOP Domain Sequences for d1uy1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uy1a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium}
spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
vnvdnfifsrss

SCOP Domain Coordinates for d1uy1a_:

Click to download the PDB-style file with coordinates for d1uy1a_.
(The format of our PDB-style files is described here.)

Timeline for d1uy1a_: