Lineage for d1uxra_ (1uxr A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493759Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 493760Superfamily c.82.1: ALDH-like [53720] (2 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 493761Family c.82.1.1: ALDH-like [53721] (4 proteins)
  6. 493916Protein Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN [82538] (1 species)
  7. 493917Species Archaeon Thermoproteus tenax [TaxId:2271] [82539] (8 PDB entries)
  8. 493920Domain d1uxra_: 1uxr A: [108124]

Details for d1uxra_

PDB Entry: 1uxr (more details), 2.3 Å

PDB Description: structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax

SCOP Domain Sequences for d1uxra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxra_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax}
agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
laggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrpyg
ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
tayktivfnykgkgvwkye

SCOP Domain Coordinates for d1uxra_:

Click to download the PDB-style file with coordinates for d1uxra_.
(The format of our PDB-style files is described here.)

Timeline for d1uxra_: