Lineage for d1uxqa_ (1uxq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140967Protein Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN [82538] (1 species)
  7. 2140968Species Thermoproteus tenax [TaxId:2271] [82539] (8 PDB entries)
    Uniprot O57693
  8. 2140974Domain d1uxqa_: 1uxq A: [108123]
    complexed with g1p, na, nap

Details for d1uxqa_

PDB Entry: 1uxq (more details), 2.4 Å

PDB Description: structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase (nadp+)

SCOPe Domain Sequences for d1uxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxqa_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Thermoproteus tenax [TaxId: 2271]}
agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
laggrrlgptyvqptfveapadrvkdmvlykrevfapvalavevkdldqaielangrpyg
ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
tayktivfnykgkgvwkye

SCOPe Domain Coordinates for d1uxqa_:

Click to download the PDB-style file with coordinates for d1uxqa_.
(The format of our PDB-style files is described here.)

Timeline for d1uxqa_: