SCOPe 2.08: Domain d1uxoa_: 1uxo A:

Lineage for d1uxoa_ (1uxo A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.31: YdeN-like [110699] (1 protein)
   Pfam PF06821; DUF1234; lack the first two strands of the common fold

6. Protein Hypothetical protein YdeN [110700] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [110701] (1 PDB entry)
   Uniprot P96671

8. Domain d1uxoa_: 1uxo A: [108121]

Details for d1uxoa_

PDB Entry: 1uxo, 1.8 Å

PDB Description: the crystal structure of the yden gene product from b. subtilis

PDB Compounds: (A:) Putative hydrolase YdeN

SCOPe Domain Sequences for d1uxoa_:

Sequence; same for both SEQRES and ATOM records:

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}
tkqvyiihgyrasstnhwfpwlkkrlladgvqadilnmpnplqprledwldtlslyqhtl
hentylvahslgcpailrflehlqlraalggiilvsgfakslptlqmldeftqgsfdhqk
iiesakhraviaskddqivpfsfskdlaqqidaalyevqhgghfledegftslpivydvl
tsyfsk

Timeline for d1uxoa_:

• d1uxoa_ first appeared in SCOP 1.69
  
• d1uxoa_ appears in SCOPe 2.07