Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Malate dehydrogenase [51849] (13 species) |
Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries) Uniprot P80040 |
Domain d1uxjc1: 1uxj C:2-143 [108114] Other proteins in same PDB: d1uxja2, d1uxjc2 complexed with cd, cl, na, nad; mutant |
PDB Entry: 1uxj (more details), 1.75 Å
SCOPe Domain Sequences for d1uxjc1:
Sequence, based on SEQRES records: (download)
>d1uxjc1 c.2.1.5 (C:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp ldamtylaaevsgfpkervigq
>d1uxjc1 c.2.1.5 (C:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg tnnyadtansdvivvtsgaedlikvnaditracisqaaplspnaviimvnnpldamtyla aevsgfpkervigq
Timeline for d1uxjc1: