![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein Malate dehydrogenase [56329] (12 species) |
![]() | Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries) Uniprot P80040 |
![]() | Domain d1uxhb2: 1uxh B:144-307 [108107] Other proteins in same PDB: d1uxha1, d1uxhb1 complexed with fum, nad; mutant |
PDB Entry: 1uxh (more details), 2.1 Å
SCOPe Domain Sequences for d1uxhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxhb2 d.162.1.1 (B:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} agvldaaryrtfiameagvsvqdvqamlmgghgdemvplprfstisgipvsefiapdrla qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi yfgvpvilgaggvekilelplneeemallnasakavratldtlk
Timeline for d1uxhb2: