SCOP 1.71: Domain d1uxhb2: 1uxh B:144-307

Lineage for d1uxhb2 (1uxh B:144-307)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Chloroflexus aurantiacus [69840] (7 PDB entries)

8. Domain d1uxhb2: 1uxh B:144-307 [108107]
   Other proteins in same PDB: d1uxha1, d1uxhb1
   complexed with fmr, nad; mutant

Details for d1uxhb2

PDB Entry: 1uxh, 2.1 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface

SCOP Domain Sequences for d1uxhb2:

Sequence; same for both SEQRES and ATOM records:

>d1uxhb2 d.162.1.1 (B:144-307) Malate dehydrogenase {Chloroflexus aurantiacus}
agvldaaryrtfiameagvsvqdvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlk

Timeline for d1uxhb2:

• d1uxhb2 first appeared in SCOP 1.69
  
• d1uxhb2 appears in SCOP 1.73
  
• d1uxhb2 appears in the current release, SCOPe 2.08