Lineage for d1uxha1 (1uxh A:2-143)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478258Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 478362Protein Malate dehydrogenase [51849] (12 species)
  7. 478395Species Chloroflexus aurantiacus [69415] (7 PDB entries)
  8. 478406Domain d1uxha1: 1uxh A:2-143 [108104]
    Other proteins in same PDB: d1uxha2, d1uxhb2

Details for d1uxha1

PDB Entry: 1uxh (more details), 2.1 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface

SCOP Domain Sequences for d1uxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxha1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq

SCOP Domain Coordinates for d1uxha1:

Click to download the PDB-style file with coordinates for d1uxha1.
(The format of our PDB-style files is described here.)

Timeline for d1uxha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxha2