SCOPe 2.08: Domain d1uxgb2: 1uxg B:144-307

Lineage for d1uxgb2 (1uxg B:144-307)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries)
   Uniprot P80040

8. Domain d1uxgb2: 1uxg B:144-307 [108103]
   Other proteins in same PDB: d1uxga1, d1uxgb1
   complexed with fum, nad; mutant

Details for d1uxgb2

PDB Entry: 1uxg, 1.9 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface.

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1uxgb2:

Sequence; same for both SEQRES and ATOM records:

>d1uxgb2 d.162.1.1 (B:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlk

Timeline for d1uxgb2:

• d1uxgb2 first appeared in SCOP 1.69
  
• d1uxgb2 appears in SCOPe 2.07