![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein Malate dehydrogenase [51849] (13 species) |
![]() | Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries) Uniprot P80040 |
![]() | Domain d1uxgb1: 1uxg B:2-143 [108102] Other proteins in same PDB: d1uxga2, d1uxgb2 complexed with fum, nad; mutant |
PDB Entry: 1uxg (more details), 1.9 Å
SCOPe Domain Sequences for d1uxgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxgb1 c.2.1.5 (B:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp ldamtylaaevsgfpkervigq
Timeline for d1uxgb1: