Lineage for d1uxga2 (1uxg A:144-307)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557069Protein Malate dehydrogenase [56329] (12 species)
  7. 2557086Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries)
    Uniprot P80040
  8. 2557095Domain d1uxga2: 1uxg A:144-307 [108101]
    Other proteins in same PDB: d1uxga1, d1uxgb1
    complexed with fum, nad; mutant

Details for d1uxga2

PDB Entry: 1uxg (more details), 1.9 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface.
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1uxga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxga2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlk

SCOPe Domain Coordinates for d1uxga2:

Click to download the PDB-style file with coordinates for d1uxga2.
(The format of our PDB-style files is described here.)

Timeline for d1uxga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxga1