Lineage for d1uxec_ (1uxe C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041113Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2041114Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2041115Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 protein domains)
    automatically mapped to Pfam PF00541
  6. 2041116Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2041129Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2041153Domain d1uxec_: 1uxe C: [108099]
    complexed with act, zn

Details for d1uxec_

PDB Entry: 1uxe (more details), 2 Å

PDB Description: adenovirus ad37 fibre head
PDB Compounds: (C:) fiber protein

SCOPe Domain Sequences for d1uxec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxec_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe

SCOPe Domain Coordinates for d1uxec_:

Click to download the PDB-style file with coordinates for d1uxec_.
(The format of our PDB-style files is described here.)

Timeline for d1uxec_: