Lineage for d1uxea_ (1uxe A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459396Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 459397Superfamily b.21.1: Virus attachment protein globular domain [49835] (2 families) (S)
  5. 459398Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 459399Protein Adenovirus fiber protein "knob" domain [49837] (5 species)
  7. 459422Species Human adenovirus type 37 [110136] (3 PDB entries)
  8. 459429Domain d1uxea_: 1uxe A: [108097]

Details for d1uxea_

PDB Entry: 1uxe (more details), 2 Å

PDB Description: adenovirus ad37 fibre head

SCOP Domain Sequences for d1uxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxea_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 37}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

SCOP Domain Coordinates for d1uxea_:

Click to download the PDB-style file with coordinates for d1uxea_.
(The format of our PDB-style files is described here.)

Timeline for d1uxea_: