Lineage for d1uxea_ (1uxe A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2371823Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2371824Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2371825Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2371826Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2371839Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2371861Domain d1uxea_: 1uxe A: [108097]
    complexed with act, zn

Details for d1uxea_

PDB Entry: 1uxe (more details), 2 Å

PDB Description: adenovirus ad37 fibre head
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d1uxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxea_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

SCOPe Domain Coordinates for d1uxea_:

Click to download the PDB-style file with coordinates for d1uxea_.
(The format of our PDB-style files is described here.)

Timeline for d1uxea_: