SCOPe 2.06: Domain d1uxbb_: 1uxb B:

Lineage for d1uxbb_ (1uxb B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (12 species)

7. Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
   Uniprot Q64823 182-365 ! Uniprot Q64823 181-365

8. Domain d1uxbb_: 1uxb B: [108095]
   complexed with act, zn

Details for d1uxbb_

PDB Entry: 1uxb, 1.75 Å

PDB Description: adenovirus ad19p fibre head in complex with sialyl-lactose

PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d1uxbb_:

Sequence; same for both SEQRES and ATOM records:

>d1uxbb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpeik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfdfswsktyenvefettsftfsyi
aqe

Timeline for d1uxbb_:

• d1uxbb_ first appeared in SCOP 1.69
  
• d1uxbb_ appears in SCOPe 2.05
  
• d1uxbb_ appears in SCOPe 2.07
  
• d1uxbb_ appears in the current release, SCOPe 2.08