| Class b: All beta proteins [48724] (149 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (2 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein) |
| Protein Adenovirus fiber protein "knob" domain [49837] (5 species) |
| Species Human adenovirus type 37 [110136] (3 PDB entries) |
| Domain d1uxac_: 1uxa C: [108093] complexed with act, gal, sia, zn; mutant |
PDB Entry: 1uxa (more details), 1.5 Å
SCOP Domain Sequences for d1uxac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxac_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus type 37}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe
Timeline for d1uxac_: