Lineage for d1uxac_ (1uxa C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459396Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 459397Superfamily b.21.1: Virus attachment protein globular domain [49835] (2 families) (S)
  5. 459398Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 459399Protein Adenovirus fiber protein "knob" domain [49837] (5 species)
  7. 459422Species Human adenovirus type 37 [110136] (3 PDB entries)
  8. 459425Domain d1uxac_: 1uxa C: [108093]

Details for d1uxac_

PDB Entry: 1uxa (more details), 1.5 Å

PDB Description: adenovirus ad37 fibre head in complex with sialyl-lactose

SCOP Domain Sequences for d1uxac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxac_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus type 37}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe

SCOP Domain Coordinates for d1uxac_:

Click to download the PDB-style file with coordinates for d1uxac_.
(The format of our PDB-style files is described here.)

Timeline for d1uxac_: