Lineage for d1uxab_ (1uxa B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776855Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2776863Domain d1uxab_: 1uxa B: [108092]
    complexed with act, zn

Details for d1uxab_

PDB Entry: 1uxa (more details), 1.5 Å

PDB Description: adenovirus ad37 fibre head in complex with sialyl-lactose
PDB Compounds: (B:) fiber protein

SCOPe Domain Sequences for d1uxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxab_ b.21.1.1 (B:) Adenovirus fiber protein 'knob' domain {Human adenovirus 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe

SCOPe Domain Coordinates for d1uxab_:

Click to download the PDB-style file with coordinates for d1uxab_.
(The format of our PDB-style files is described here.)

Timeline for d1uxab_: