| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Cytoglobin [109626] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries) Uniprot Q8WWM9 18-171 |
| Domain d1ux9b_: 1ux9 B: [108090] complexed with fc6, hem, xe |
PDB Entry: 1ux9 (more details), 2.4 Å
SCOPe Domain Sequences for d1ux9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux9b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw
Timeline for d1ux9b_: