SCOP 1.69: Domain d1ux9b_: 1ux9 B:

Lineage for d1ux9b_ (1ux9 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Cytoglobin [109626] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109627] (4 PDB entries)

8. Domain d1ux9b_: 1ux9 B: [108090]

Details for d1ux9b_

PDB Entry: 1ux9, 2.4 Å

PDB Description: mapping protein matrix cavities in human cytoglobin through xe atom binding: a crystallographic investigation

SCOP Domain Sequences for d1ux9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ux9b_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens)}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d1ux9b_:

• d1ux9b_ is new in SCOP 1.69
  
• d1ux9b_ appears in SCOP 1.71
  
• d1ux9b_ appears in the current release, SCOPe 2.08