Lineage for d1ux1d_ (1ux1 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495641Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 495642Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) (S)
  5. 495643Family c.97.1.1: Cytidine deaminase [53928] (2 proteins)
  6. 495644Protein mono-domain cytidine deaminase [75327] (3 species)
  7. 495645Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)
  8. 495655Domain d1ux1d_: 1ux1 D: [108088]

Details for d1ux1d_

PDB Entry: 1ux1 (more details), 2.36 Å

PDB Description: bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution

SCOP Domain Sequences for d1ux1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux1d_ c.97.1.1 (D:) mono-domain cytidine deaminase {Bacillus subtilis}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedlh

SCOP Domain Coordinates for d1ux1d_:

Click to download the PDB-style file with coordinates for d1ux1d_.
(The format of our PDB-style files is described here.)

Timeline for d1ux1d_: