SCOP 1.73: Domain d1ux1b_: 1ux1 B:

Lineage for d1ux1b_ (1ux1 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)

8. Domain d1ux1b_: 1ux1 B: [108086]

Details for d1ux1b_

PDB Entry: 1ux1, 2.36 Å

PDB Description: bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution

PDB Compounds: (B:) Cytidine deaminase

SCOP Domain Sequences for d1ux1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ux1b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedl

Timeline for d1ux1b_:

• d1ux1b_ first appeared in SCOP 1.69
  
• d1ux1b_ appears in SCOP 1.71
  
• d1ux1b_ appears in SCOP 1.75
  
• d1ux1b_ appears in the current release, SCOPe 2.08