Lineage for d1ux1b_ (1ux1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918487Protein mono-domain cytidine deaminase [75327] (6 species)
  7. 2918491Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)
    Uniprot P19079
  8. 2918499Domain d1ux1b_: 1ux1 B: [108086]
    complexed with thu, trs, zn

Details for d1ux1b_

PDB Entry: 1ux1 (more details), 2.36 Å

PDB Description: bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution
PDB Compounds: (B:) Cytidine deaminase

SCOPe Domain Sequences for d1ux1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux1b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedl

SCOPe Domain Coordinates for d1ux1b_:

Click to download the PDB-style file with coordinates for d1ux1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ux1b_: