![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
![]() | Protein mono-domain cytidine deaminase [75327] (6 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries) Uniprot P19079 |
![]() | Domain d1ux1b_: 1ux1 B: [108086] complexed with thu, trs, zn |
PDB Entry: 1ux1 (more details), 2.36 Å
SCOPe Domain Sequences for d1ux1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux1b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]} mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcnhaeqtalf kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel lpgafssedl
Timeline for d1ux1b_: