SCOPe 2.05: Domain d1uwzb_: 1uwz B:

Lineage for d1uwzb_ (1uwz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)
   Uniprot P19079

8. Domain d1uwzb_: 1uwz B: [108082]
   complexed with thu, zn

Details for d1uwzb_

PDB Entry: 1uwz, 1.99 Å

PDB Description: bacillus subtilis cytidine deaminase with an arg56 - ala substitution

PDB Compounds: (B:) Cytidine deaminase

SCOPe Domain Sequences for d1uwzb_:

Sequence; same for both SEQRES and ATOM records:

>d1uwzb_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaeatalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedl

Timeline for d1uwzb_:

• d1uwzb_ first appeared in SCOP 1.69
  
• d1uwzb_ appears in SCOPe 2.04
  
• d1uwzb_ appears in SCOPe 2.06
  
• d1uwzb_ appears in the current release, SCOPe 2.08