Lineage for d1uwwb_ (1uww B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774857Family b.18.1.23: Family 28 carbohydrate binding module, CBM28 [110122] (1 protein)
    automatically mapped to Pfam PF03424
  6. 2774858Protein Endoglucanase (alkaline cellulase) [110123] (1 species)
  7. 2774859Species Bacillus sp. 1139 [TaxId:1411] [110124] (1 PDB entry)
    Uniprot P06564 578-761
  8. 2774861Domain d1uwwb_: 1uww B: [108080]
    complexed with ca

Details for d1uwwb_

PDB Entry: 1uww (more details), 1.4 Å

PDB Description: x-ray crystal structure of a non-crystalline cellulose specific carbohydrate-binding module: cbm28.
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d1uwwb_:

Sequence, based on SEQRES records: (download)

>d1uwwb_ b.18.1.23 (B:) Endoglucanase (alkaline cellulase) {Bacillus sp. 1139 [TaxId: 1411]}
ipvvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypevkps
dnwataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapkt
ytinfdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdn
vrfeg

Sequence, based on observed residues (ATOM records): (download)

>d1uwwb_ b.18.1.23 (B:) Endoglucanase (alkaline cellulase) {Bacillus sp. 1139 [TaxId: 1411]}
ipvvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypewata
prldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktytinfd
eleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvrfeg

SCOPe Domain Coordinates for d1uwwb_:

Click to download the PDB-style file with coordinates for d1uwwb_.
(The format of our PDB-style files is described here.)

Timeline for d1uwwb_: