Lineage for d1uwwa_ (1uww A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459226Family b.18.1.23: Family 28 carbohydrate binding module, CBM28 [110122] (1 protein)
  6. 459227Protein Endoglucanase (alkaline cellulase) [110123] (1 species)
  7. 459228Species Bacillus sp. 1139 [TaxId:1411] [110124] (1 PDB entry)
  8. 459229Domain d1uwwa_: 1uww A: [108079]

Details for d1uwwa_

PDB Entry: 1uww (more details), 1.4 Å

PDB Description: x-ray crystal structure of a non-crystalline cellulose specific carbohydrate-binding module: cbm28.

SCOP Domain Sequences for d1uwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwwa_ b.18.1.23 (A:) Endoglucanase (alkaline cellulase) {Bacillus sp. 1139}
vvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypevkpsdn
wataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktyt
infdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvr
fega

SCOP Domain Coordinates for d1uwwa_:

Click to download the PDB-style file with coordinates for d1uwwa_.
(The format of our PDB-style files is described here.)

Timeline for d1uwwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwwb_