SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1uwwa_ (1uww A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039853Family b.18.1.23: Family 28 carbohydrate binding module, CBM28 [110122] (1 protein)
    automatically mapped to Pfam PF03424
  6. 2039854Protein Endoglucanase (alkaline cellulase) [110123] (1 species)
  7. 2039855Species Bacillus sp. 1139 [TaxId:1411] [110124] (1 PDB entry)
    Uniprot P06564 578-761
  8. 2039856Domain d1uwwa_: 1uww A: [108079]
    complexed with ca

Details for d1uwwa_

PDB Entry: 1uww (more details), 1.4 Å

PDB Description: x-ray crystal structure of a non-crystalline cellulose specific carbohydrate-binding module: cbm28.
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1uwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwwa_ b.18.1.23 (A:) Endoglucanase (alkaline cellulase) {Bacillus sp. 1139 [TaxId: 1411]}
vvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypevkpsdn
wataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktyt
infdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvr
fega

SCOPe Domain Coordinates for d1uwwa_:

Click to download the PDB-style file with coordinates for d1uwwa_.
(The format of our PDB-style files is described here.)

Timeline for d1uwwa_: