SCOPe 2.08: Domain d1uwwa_: 1uww A:

Lineage for d1uwwa_ (1uww A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.23: Family 28 carbohydrate binding module, CBM28 [110122] (1 protein)
   automatically mapped to Pfam PF03424

6. Protein Endoglucanase (alkaline cellulase) [110123] (1 species)

7. Species Bacillus sp. 1139 [TaxId:1411] [110124] (1 PDB entry)
   Uniprot P06564 578-761

8. Domain d1uwwa_: 1uww A: [108079]
   complexed with ca

Details for d1uwwa_

PDB Entry: 1uww, 1.4 Å

PDB Description: x-ray crystal structure of a non-crystalline cellulose specific carbohydrate-binding module: cbm28.

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1uwwa_:

Sequence; same for both SEQRES and ATOM records:

>d1uwwa_ b.18.1.23 (A:) Endoglucanase (alkaline cellulase) {Bacillus sp. 1139 [TaxId: 1411]}
vvhdpkgeavlpsvfedgtrqgwdwagesgvktaltieeangsnalswefgypevkpsdn
wataprldfwksdlvrgendyvtfdfyldpvrategamninlvfqpptngywvqapktyt
infdeleeanqvnglyhyevkinvrditniqddtllrnmmiifadvesdfagrvfvdnvr
fega

Timeline for d1uwwa_:

• d1uwwa_ first appeared in SCOP 1.69
  
• d1uwwa_ appears in SCOPe 2.07