Lineage for d1uwub_ (1uwu B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094473Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2094560Protein beta-Glycosidase [51531] (2 species)
  7. 2094561Species Sulfolobus solfataricus [TaxId:2287] [51532] (9 PDB entries)
    Uniprot P22498
  8. 2094567Domain d1uwub_: 1uwu B: [108078]
    complexed with act, gox

Details for d1uwub_

PDB Entry: 1uwu (more details), 1.95 Å

PDB Description: structure of beta-glycosidase from sulfolobus solfataricus in complex with d-glucohydroximo-1,5-lactam
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1uwub_:

Sequence, based on SEQRES records: (download)

>d1uwub_ c.1.8.4 (B:) beta-Glycosidase {Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d1uwub_ c.1.8.4 (B:) beta-Glycosidase {Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
ffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgy
lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
pvkplrh

SCOPe Domain Coordinates for d1uwub_:

Click to download the PDB-style file with coordinates for d1uwub_.
(The format of our PDB-style files is described here.)

Timeline for d1uwub_: