Lineage for d1uwrb_ (1uwr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082994Protein beta-Glycosidase [51531] (2 species)
  7. 2082995Species Sulfolobus solfataricus [TaxId:2287] [51532] (9 PDB entries)
    Uniprot P22498
  8. 2083011Domain d1uwrb_: 1uwr B: [108072]
    complexed with act, gaf

Details for d1uwrb_

PDB Entry: 1uwr (more details), 2.14 Å

PDB Description: structure of beta-glycosidase from sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-galactose
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1uwrb_:

Sequence, based on SEQRES records: (download)

>d1uwrb_ c.1.8.4 (B:) beta-Glycosidase {Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d1uwrb_ c.1.8.4 (B:) beta-Glycosidase {Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeiteki
vrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffp
eglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylhw
sladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvk
plrh

SCOPe Domain Coordinates for d1uwrb_:

Click to download the PDB-style file with coordinates for d1uwrb_.
(The format of our PDB-style files is described here.)

Timeline for d1uwrb_: