Lineage for d1uwra_ (1uwr A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474776Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 474839Protein beta-Glycosidase [51531] (2 species)
  7. 474840Species Archaeon Sulfolobus solfataricus [TaxId:2287] [51532] (6 PDB entries)
  8. 474849Domain d1uwra_: 1uwr A: [108071]

Details for d1uwra_

PDB Entry: 1uwr (more details), 2.14 Å

PDB Description: structure of beta-glycosidase from sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-galactose

SCOP Domain Sequences for d1uwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwra_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

SCOP Domain Coordinates for d1uwra_:

Click to download the PDB-style file with coordinates for d1uwra_.
(The format of our PDB-style files is described here.)

Timeline for d1uwra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwrb_